Kallikrein-5, Mouse (271a.a, HEK293, His)
The Kallikrein-5 protein may be involved in desquamation, suggesting a role in the process of skin shedding and exfoliation. Its association with desquamation suggests that it plays a role in regulating the removal of dead skin cells, which is critical for skin homeostasis. Kallikrein-5 Protein, Mouse (271a.a, HEK293, His) is the recombinant mouse-derived Kallikrein-5 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
Kallikrein-5 Protein, Mouse (271a.a, HEK293, His), Mouse, HEK293
UNSPSC
12352202
Purity
95.00
Smiles
VSEPVLAGDVSSCDNPSGTEPSGTNRDLSTDSKSGEDTRSDSSSRIVNGSDCQKDAQPWQGALLLGPNKLYCGAVLISPQWLLTAAHCRKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLMLIKMNRKIRDSHSVKPVEIACDCATEGTRCMVSGWGTTSSSHNNFPKVLQCLNITVLSEERCKNSYPGQIDKTMFCAGDEEGRDSCQGDSGGPVVCNGKLQGLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNSN
Molecular Formula
68668 (Gene_ID) Q9D140 (V23-N293) (Accession)
Molecular Weight
Approximately 35-50 kDa due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402853-100 1x 100 µL
CD54 / ICAM-1 (15.2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402823-100 1x 100 µL
BMI1 (Oncogene and Stem Cell Marker) (BMI1/2823), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details