Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRMT5 Protein, Human (HEK293, His-Flag)

PRMT5 protein, an enzyme from the methyltransferase family, methylates arginine in target proteins like histones, p53, and transcription factors. It regulates transcription and small nuclear ribonucleoprotein assembly. Alternative splicing generates diverse PRMT5 transcript variants. It is widely expressed, particularly in the thyroid, ovary, and other tissues, emphasizing its crucial role in cellular processes. PRMT5 Protein, Human (HEK293, His-Flag) is the recombinant human-derived PRMT5, expressed by HEK293, with N-Flag, C-His labeled tag.

Product Specifications

Product Name Alternative

PRMT5 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Smiles

AMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Molecular Formula

10419 (Gene_ID) NP_006100.2 (A2-L637) (Accession)

Molecular Weight

Approximately 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-,  40nm
GP-5901-40 1 mL

Colloidal Gold Conjugated Erythrina cristagalli Lectin (Coral Tree) -ECA-, 40nm

Sign In for Pricing
View Details
7-Aminodesacetoxycephalosporanic Acid
TRC-A604330-50MG 50 mg

7-Aminodesacetoxycephalosporanic Acid

Sign In for Pricing
View Details
EDA Human Gene Knockout Kit (CRISPR)
KN415573 1 Kit

EDA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSPA6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
TA501950AM 100 µL

HSPA6 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker), CF405S conjugate, 0.1mg/mL
BNC041655-500 1x 500 µL

NKX2.2 (Neuroendocrine & Ewing's Sarcoma Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGLN2 (NM_053046) Human Over-expression Lysate
LC403281 20 µg

EGLN2 (NM_053046) Human Over-expression Lysate

Sign In for Pricing
View Details