Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRMT5 Protein, Human (HEK293, His-Flag)

PRMT5 protein, an enzyme from the methyltransferase family, methylates arginine in target proteins like histones, p53, and transcription factors. It regulates transcription and small nuclear ribonucleoprotein assembly. Alternative splicing generates diverse PRMT5 transcript variants. It is widely expressed, particularly in the thyroid, ovary, and other tissues, emphasizing its crucial role in cellular processes. PRMT5 Protein, Human (HEK293, His-Flag) is the recombinant human-derived PRMT5, expressed by HEK293, with N-Flag, C-His labeled tag.

Product Specifications

Product Name Alternative

PRMT5 Protein, Human (HEK293, His-Flag), Human, HEK293

UNSPSC

12352202

Smiles

AMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL

Molecular Formula

10419 (Gene_ID) NP_006100.2 (A2-L637) (Accession)

Molecular Weight

Approximately 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF323 (ZSCAN31) (NM_030899) Human Recombinant Protein
TP303342L 1 mg

ZNF323 (ZSCAN31) (NM_030899) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant p16 ARC Monoclonal Antibody
E-AB-81590-01 50 µL

Recombinant p16 ARC Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant p16 ARC Monoclonal Antibody
E-AB-81590-02 100 µL

Recombinant p16 ARC Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat EGF Protein (Gst Tag)
PDER100116-01 20 µg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat EGF Protein (Gst Tag)
PDER100116-02 100 µg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Rat EGF Protein (Gst Tag)
PDER100116-03 500 µg

Recombinant Rat EGF Protein (Gst Tag)

Sign In for Pricing
View Details