CIAP1/BIRC2, Human (Avi)
CIAP1/BIRC2 Protein, Human (Avi) is the recombinant human-derived cIAP1/BIRC2 protein, expressed by E. coli, with C-Avi tag.
Product Specifications
Product Name Alternative
CIAP1/BIRC2 Protein, Human (Avi), Human, E. coli
UNSPSC
12352202
Smiles
EHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL
Molecular Formula
329 (Gene_ID) NP_001157.1 (N-G&P, E144-L356) (Accession)
Molecular Weight
Approximately 26.5 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RP00479-01 100 μg
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
Sign In for Pricing
View Details RP00479-02 500 μg
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
Sign In for Pricing
View Details RP00479-03 1000 μg
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
Sign In for Pricing
View Details