CIAP1/BIRC2, Human (Avi)
CIAP1/BIRC2 Protein, Human (Avi) is the recombinant human-derived cIAP1/BIRC2 protein, expressed by E. coli, with C-Avi tag.
Product Specifications
Product Name Alternative
CIAP1/BIRC2 Protein, Human (Avi), Human, E. coli
UNSPSC
12352202
Smiles
EHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLL
Molecular Formula
329 (Gene_ID) NP_001157.1 (N-G&P, E144-L356) (Accession)
Molecular Weight
Approximately 26.5 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
128458-FITC 100 µL
IL2RA (Interleukin-2 Receptor Subunit alpha, IL-2 Receptor Subunit alpha, IL-2-RA, IL-2R Subunit alpha, IL2-RA, TAC Antigen, p55, CD25) (FITC)
Ask
View Details