Bax, Human (His)
Bax Protein, Human (His) suppresses tumorigenesis and stimulates apoptosis. BCL2L4 (BAX) is the proapoptotic members of the Bcl-2 family that are ubiquitously expressed in different tissues[1][2][3].
Product Specifications
Product Name Alternative
Bax Protein, Human (His), Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQ
Molecular Formula
581 (Gene_ID) Q07812-1 (M1-Q171) (Accession)
Molecular Weight
Approximately 20 kDa
References & Citations
[1]Chaoying Yin, et al. Bax suppresses tumorigenesis and stimulates apoptosis in vivo. Nature. 1997 Feb 13;385 (6617) :637-40.|[2]Luca Scorrano, et al. BAX and BAK regulation of endoplasmic reticulum Ca2+: a control point for apoptosis. Science. 2003 Apr 4;300 (5616) :135-9.|[3]Wei-Xing Zong, et al. Bax and Bak can localize to the endoplasmic reticulum to initiate apoptosis. J Cell Biol. 2003 Jul 7;162 (1) :59-69.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
245375-ML490 100 µL
DLG1 (discs, Large Homolog 1 (Drosophila), DKFZp761P0818, DKFZp781B0426, DLGH1, SAP-97, SAP97, dJ1061C18.1.1, hdlg) (MaxLight 490)
Ask
View Details 
MBS6506366-01 0.2 mL
YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)
Ask
View Details MBS6506366-02 5x 0.2 mL
YBOX1, NT (Nuclease-sensitive Element-binding Protein 1, Y-box-binding Protein 1, Y-box Transcription Factor, YB-1, CCAAT-binding, Transcription Factor I Subunit A, CBF-A, Enhancer Factor I Subunit A, EFI-A, DNA-binding Protein B, DBPB, YBX1, NSEP1, YB1)
Ask
View Details 
MBS6273274-01 0.1 mL
AMIGO3, ID (AMIGO3, ALI3, KIAA1851, Amphoterin-induced protein 3, AMIGO-3, Alivin-3) (MaxLight 490)
Ask
View Details MBS6273274-02 5x 0.1 mL
AMIGO3, ID (AMIGO3, ALI3, KIAA1851, Amphoterin-induced protein 3, AMIGO-3, Alivin-3) (MaxLight 490)
Ask
View Details