Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bax, Human (His)

Bax Protein, Human (His) suppresses tumorigenesis and stimulates apoptosis. BCL2L4 (BAX) is the proapoptotic members of the Bcl-2 family that are ubiquitously expressed in different tissues[1][2][3].

Product Specifications

Product Name Alternative

Bax Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQ

Molecular Formula

581 (Gene_ID) Q07812-1 (M1-Q171) (Accession)

Molecular Weight

Approximately 20 kDa

References & Citations

[1]Chaoying Yin, et al. Bax suppresses tumorigenesis and stimulates apoptosis in vivo. Nature. 1997 Feb 13;385 (6617) :637-40.|[2]Luca Scorrano, et al. BAX and BAK regulation of endoplasmic reticulum Ca2+: a control point for apoptosis. Science. 2003 Apr 4;300 (5616) :135-9.|[3]Wei-Xing Zong, et al. Bax and Bak can localize to the endoplasmic reticulum to initiate apoptosis. J Cell Biol. 2003 Jul 7;162 (1) :59-69.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SIPA1L2 Antibody, FITC conjugated
A69773-50UG 50 µg

SIPA1L2 Antibody, FITC conjugated

Ask
View Details
C19orf81 Human Pre-designed siRNA Set A
HY-RS16373 1 Set

C19orf81 Human Pre-designed siRNA Set A

Ask
View Details
Rabbit Polyclonal Ephrin-A5 Antibody [PE]
NBP2-98318PE 0.1 mL

Rabbit Polyclonal Ephrin-A5 Antibody [PE]

Ask
View Details
FAM113A (PCED1A) (NM_022760) Human Tagged ORF Clone
RG208647 10 µg

FAM113A (PCED1A) (NM_022760) Human Tagged ORF Clone

Ask
View Details
Mouse Monoclonal Angiopoietin-1 Antibody (MM0019-26B10) [mFluor Violet 610 SE]
NB110-85464MFV610 0.1 mL

Mouse Monoclonal Angiopoietin-1 Antibody (MM0019-26B10) [mFluor Violet 610 SE]

Ask
View Details