Bax, Human (His)
Bax Protein, Human (His) suppresses tumorigenesis and stimulates apoptosis. BCL2L4 (BAX) is the proapoptotic members of the Bcl-2 family that are ubiquitously expressed in different tissues[1][2][3].
Product Specifications
Product Name Alternative
Bax Protein, Human (His), Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQ
Molecular Formula
581 (Gene_ID) Q07812-1 (M1-Q171) (Accession)
Molecular Weight
Approximately 20 kDa
References & Citations
[1]Chaoying Yin, et al. Bax suppresses tumorigenesis and stimulates apoptosis in vivo. Nature. 1997 Feb 13;385 (6617) :637-40.|[2]Luca Scorrano, et al. BAX and BAK regulation of endoplasmic reticulum Ca2+: a control point for apoptosis. Science. 2003 Apr 4;300 (5616) :135-9.|[3]Wei-Xing Zong, et al. Bax and Bak can localize to the endoplasmic reticulum to initiate apoptosis. J Cell Biol. 2003 Jul 7;162 (1) :59-69.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6664108 1.0 µg DNA
Rilpl1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
127812-APC 100 µL
HES2 (Transcription Factor HES-2, Class B Basic Helix-loop-helix Protein 40, bHLHb40, Hairy and Enhancer of Split 2, BHLHB40) (APC)
Sign In for Pricing
View Details NBP2-31211IR 0.1 mL
Mouse Monoclonal Cathepsin Z Antibody (6G11) [DyLight 755]
Sign In for Pricing
View Details A02138-3-HRP 100 µg/Vial
Anti-XRCC2 Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details