Bax, Human (His)
Bax Protein, Human (His) suppresses tumorigenesis and stimulates apoptosis. BCL2L4 (BAX) is the proapoptotic members of the Bcl-2 family that are ubiquitously expressed in different tissues[1][2][3].
Product Specifications
Product Name Alternative
Bax Protein, Human (His), Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQ
Molecular Formula
581 (Gene_ID) Q07812-1 (M1-Q171) (Accession)
Molecular Weight
Approximately 20 kDa
References & Citations
[1]Chaoying Yin, et al. Bax suppresses tumorigenesis and stimulates apoptosis in vivo. Nature. 1997 Feb 13;385 (6617) :637-40.|[2]Luca Scorrano, et al. BAX and BAK regulation of endoplasmic reticulum Ca2+: a control point for apoptosis. Science. 2003 Apr 4;300 (5616) :135-9.|[3]Wei-Xing Zong, et al. Bax and Bak can localize to the endoplasmic reticulum to initiate apoptosis. J Cell Biol. 2003 Jul 7;162 (1) :59-69.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NO2080J 2.5 L
Reagecon Wash Solution 2L DI Water + 100ml Nitric Acid (HNO3) Added
Sign In for Pricing
View Details 
![RGL2 Mouse Monoclonal Antibody [Clone 9H3]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)