Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR37, Human (HEK293, His)

GPR37 Protein, a receptor for prosaposin, undergoes endocytosis upon ligand binding, initiating an ERK phosphorylation cascade. It forms a complex with PRKN, STUB1, and HSP70, with STUB1 association increasing during ER stress. STUB1 facilitates HSP70 dissociation from PRKN, promoting PRKN-mediated ubiquitination of GPR37. GPR37 also interacts with PACRG, indicating a complex regulatory network in its cellular functions. GPR37 Protein, Human (HEK293, His) is the recombinant human-derived GPR37, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

GPR37 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM

Molecular Formula

2861 (Gene_ID) NP_005293.1/O15354 (A27-M265) (Accession)

Molecular Weight

Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HIRA, NT (HIRA, DGCR1, HIR, TUPLE1, Protein HIRA, TUP1-like enhancer of split protein 1) (MaxLight 490)
MBS6306610-01 0.1 mL

HIRA, NT (HIRA, DGCR1, HIR, TUPLE1, Protein HIRA, TUP1-like enhancer of split protein 1) (MaxLight 490)

Ask
View Details
HIRA, NT (HIRA, DGCR1, HIR, TUPLE1, Protein HIRA, TUP1-like enhancer of split protein 1) (MaxLight 490)
MBS6306610-02 5x 0.1 mL

HIRA, NT (HIRA, DGCR1, HIR, TUPLE1, Protein HIRA, TUP1-like enhancer of split protein 1) (MaxLight 490)

Ask
View Details
Recombinant Human HES7 Protein, His, E.coli-5ug
QP12220-5ug 5ug

Recombinant Human HES7 Protein, His, E.coli-5ug

Ask
View Details
GSTA1 (Glutathione S-Transferase alpha 1, GST2, GSTA1-1, GTH1, MGC131939) (APC)
MBS6166012-01 0.1 mL

GSTA1 (Glutathione S-Transferase alpha 1, GST2, GSTA1-1, GTH1, MGC131939) (APC)

Ask
View Details
GSTA1 (Glutathione S-Transferase alpha 1, GST2, GSTA1-1, GTH1, MGC131939) (APC)
MBS6166012-02 5x 0.1 mL

GSTA1 (Glutathione S-Transferase alpha 1, GST2, GSTA1-1, GTH1, MGC131939) (APC)

Ask
View Details
DGCR2 Recombinant Protein Antigen
NBP2-56538PEP 100 µL

DGCR2 Recombinant Protein Antigen

Ask
View Details