Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR37, Human (HEK293, His)

GPR37 Protein, a receptor for prosaposin, undergoes endocytosis upon ligand binding, initiating an ERK phosphorylation cascade. It forms a complex with PRKN, STUB1, and HSP70, with STUB1 association increasing during ER stress. STUB1 facilitates HSP70 dissociation from PRKN, promoting PRKN-mediated ubiquitination of GPR37. GPR37 also interacts with PACRG, indicating a complex regulatory network in its cellular functions. GPR37 Protein, Human (HEK293, His) is the recombinant human-derived GPR37, expressed by HEK293, with C-His labeled tag.

Product Specifications

Product Name Alternative

GPR37 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM

Molecular Formula

2861 (Gene_ID) NP_005293.1/O15354 (A27-M265) (Accession)

Molecular Weight

Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOG Peptide - C-terminal region (AAP60186)
AAP60186-100UG 100 µg

RHOG Peptide - C-terminal region (AAP60186)

Sign In for Pricing
View Details
PHAP1 (ANP32A) (NM_006305) Human Over-expression Lysate
LS008125-100ug 100 µg

PHAP1 (ANP32A) (NM_006305) Human Over-expression Lysate

Sign In for Pricing
View Details
Foxn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4952808 1.0 µg DNA

Foxn3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human SPIB shRNA (UAS) - Lentiviral human SPIB shRNA (UAS, iRFP) (25)
GTR15091802 1 Vial

Lentiviral human SPIB shRNA (UAS) - Lentiviral human SPIB shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Goat anti-Prolyl Endopeptidase/PREP Antibody
MBS420439-01 0.1 mg

Goat anti-Prolyl Endopeptidase/PREP Antibody

Sign In for Pricing
View Details
Goat anti-Prolyl Endopeptidase/PREP Antibody
MBS420439-02 5x 0.1 mg

Goat anti-Prolyl Endopeptidase/PREP Antibody

Sign In for Pricing
View Details