Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT2, Human (HEK293, His)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, His) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

B3GNT2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

95

Smiles

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Molecular Formula

10678 (Gene_ID) Q9NY97-1 (K29-C397) (Accession)

Molecular Weight

Approximately 55-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC83 (NM_173556) Human Recombinant Protein
TP323659 20 µg

CCDC83 (NM_173556) Human Recombinant Protein

Sign In for Pricing
View Details
Ruxolitinib Phosphate
TRC-R702005-250MG 250 mg

Ruxolitinib Phosphate

Sign In for Pricing
View Details
EASYStep Pro Human Estriol (E3) ELISA Kit
RDEp-E3-Hu 96 Tests

EASYStep Pro Human Estriol (E3) ELISA Kit

Sign In for Pricing
View Details
SENP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]
TA800001BM 100 µL

SENP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details
5-Amino-2-bromobenzoic Acid
TRC-A602490-5G 5 g

5-Amino-2-bromobenzoic Acid

Sign In for Pricing
View Details
Uncoated Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit
E-UNEL-H0298-01 5x 96 Tests

Uncoated Human TIMP-4 (Tissue Inhibitors of Metalloproteinase 4) ELISA Kit

Sign In for Pricing
View Details