Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT2, Human (HEK293, His)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, His) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

B3GNT2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

95

Smiles

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Molecular Formula

10678 (Gene_ID) Q9NY97-1 (K29-C397) (Accession)

Molecular Weight

Approximately 55-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]
TA506183AM 100 µL

RFC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A8]

Sign In for Pricing
View Details
IRS2 pTyr978 Rabbit Polyclonal Antibody
AP13006PU-N 400 µL

IRS2 pTyr978 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,1':2',1'':2'',1'''-Quaterphenyl
TRC-Q509450-250MG 250 mg

1,1':2',1'':2'',1'''-Quaterphenyl

Sign In for Pricing
View Details
Dichloroacetic anhydride
TRC-D189760-1G 1 g

Dichloroacetic anhydride

Sign In for Pricing
View Details
2-Cyano-3-(3-chlorophenylethyl)pyridine
TRC-C962450-50MG 50 mg

2-Cyano-3-(3-chlorophenylethyl)pyridine

Sign In for Pricing
View Details
Mouse IL-1 alpha/IL1A, C-His Tag
HA210971-01 Inquire

Mouse IL-1 alpha/IL1A, C-His Tag

Sign In for Pricing
View Details