Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT2, Human (HEK293, His)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, His) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

B3GNT2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

95

Smiles

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Molecular Formula

10678 (Gene_ID) Q9NY97-1 (K29-C397) (Accession)

Molecular Weight

Approximately 55-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM Immunoglobulin (IM373), CF568 conjugate, 0.1mg/mL
BNC680373-100 1x 100 µL

Human IgM Immunoglobulin (IM373), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-(2-Phenylethyl)piperazine
TRC-P321325-5G 5 g

1-(2-Phenylethyl)piperazine

Sign In for Pricing
View Details
IRAK (IRAK1) Rabbit Polyclonal Antibody
AP06527PU-N 100 µg

IRAK (IRAK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cybb activation kit by CRISPRa
GA200964 1 Kit

Mouse Cybb activation kit by CRISPRa

Sign In for Pricing
View Details
Factor I (CFI) Rabbit Polyclonal Antibody
AP54862PU-N 100 µg

Factor I (CFI) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DIP13B (APPL2) (NM_018171) Human Recombinant Protein
TP307506M 100 µg

DIP13B (APPL2) (NM_018171) Human Recombinant Protein

Sign In for Pricing
View Details