Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GNT2, Human (HEK293, His)

The B3GNT2 protein is a member of the zinc-containing alcohol dehydrogenase family and facilitates the oxidation of alcohols to their corresponding carbonyl compounds. This enzyme is widely distributed in organisms, has zinc ions in its active site, and catalyzes substrate conversion through dehydrogenation. B3GNT2 Protein, Human (HEK293, His) is the recombinant human-derived B3GNT2 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

B3GNT2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

95

Smiles

KSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

Molecular Formula

10678 (Gene_ID) Q9NY97-1 (K29-C397) (Accession)

Molecular Weight

Approximately 55-130 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX13 (NM_005686) Human Over-expression Lysate
LC401735 20 µg

SOX13 (NM_005686) Human Over-expression Lysate

Sign In for Pricing
View Details
mIgG (1,2a,2b,3) Rabbit Monoclonal Antibody [Clone ID: OTIR12F3]
TA592638 100 µL

mIgG (1,2a,2b,3) Rabbit Monoclonal Antibody [Clone ID: OTIR12F3]

Sign In for Pricing
View Details
RQCD1 (CNOT9) Human Gene Knockout Kit (CRISPR)
KN216067RB 1 Kit

RQCD1 (CNOT9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 (TP53) Rabbit Polyclonal Antibody
AP20989PU-N 100 µg

p53 (TP53) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GATA1 (NM_002049) Human Over-expression Lysate
LY400758 100 µg

GATA1 (NM_002049) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR Rat Monoclonal Antibody [Clone ID: SB41a]
AM08180PU-N 100 µg

EGFR Rat Monoclonal Antibody [Clone ID: SB41a]

Sign In for Pricing
View Details