ADAM15, Human (HEK293, His)
ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
ADAM15 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Purity
96.00
Smiles
DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT
Molecular Formula
8751 (Gene_ID) Q13444 (D207-T696) (Accession)
Molecular Weight
Approximately 65-80 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470034-500 1x 500 µL
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880146-100 1x 100 µL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471081-100 1x 100 µL
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 