Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM15, Human (HEK293, His)

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ADAM15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

96.00

Smiles

DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT

Molecular Formula

8751 (Gene_ID) Q13444 (D207-T696) (Accession)

Molecular Weight

Approximately 65-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 6 Receptor (IL6R) ELISA Kit
RD-IL6R-Hu-01 96 Tests

Human Interleukin 6 Receptor (IL6R) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 6 Receptor (IL6R) ELISA Kit
RD-IL6R-Hu-02 48 Tests

Human Interleukin 6 Receptor (IL6R) ELISA Kit

Sign In for Pricing
View Details
Crb2 siRNA Oligos set (Mouse)
16804174 3x 5 nmol

Crb2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
MRPS33P2 AAV Vector (Human) (CMV)
30583101 1 µg

MRPS33P2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
HGF, Human
Z03229-10 10 µg

HGF, Human

Sign In for Pricing
View Details
α-Ethenyl-2-methoxy-4- (trifluoromethyl) benzenemethanol
PC1015687-01 250 mg

α-Ethenyl-2-methoxy-4- (trifluoromethyl) benzenemethanol

Sign In for Pricing
View Details