Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM15, Human (HEK293, His)

ADAM15 protein is an active metalloprotease involved in wound healing, cell interactions, and T cell recruitment. It inhibits airway smooth muscle cell adhesion and migration mediated by beta-1 integrin. ADAM15 Protein, Human (HEK293, His) is the recombinant human-derived ADAM15 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

ADAM15 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Purity

96.00

Smiles

DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLTCQLRPGAQCASDGPCCQNCQLRPSGWQCRPTRGDCDLPEFCPGDSSQCPPDVSLGDGEPCAGGQAVCMHGRCASYAQQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQPLLGSIRDLLWETIDVNGTELNCSWVHLDLGSDVAQPLLTLPGTACGPGLVCIDHRCQRVDLLGAQECRSKCHGHGVCDSNRHCYCEEGWAPPDCTTQLKATSSLTT

Molecular Formula

8751 (Gene_ID) Q13444 (D207-T696) (Accession)

Molecular Weight

Approximately 65-80 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HnrnpµL2 Mouse shRNA Plasmid (Locus ID 68693)

TR517944 1 Kit

HnrnpµL2 Mouse shRNA Plasmid (Locus ID 68693)

Sign In for Pricing

Rabbit Polyclonal Parvalbumin Antibody [Alexa Fluor 350]

NBP2-97030AF350 0.1 mL

Rabbit Polyclonal Parvalbumin Antibody [Alexa Fluor 350]

Sign In for Pricing

DNAJC14, ID (DNAJC14, DRIP78, HDJ3, DnaJ homolog subfamily C member 14, DnaJ protein homolog 3, Dopamine receptor-interacting protein of 78kD, Human DnaJ protein 3) (MaxLight 650) discontinued

034710-ML650 100 µL

DNAJC14, ID (DNAJC14, DRIP78, HDJ3, DnaJ homolog subfamily C member 14, DnaJ protein homolog 3, Dopamine receptor-interacting protein of 78kD, Human DnaJ protein 3) (MaxLight 650) discontinued

Sign In for Pricing

Mouse Transforming Growth Factor Alpha CLIA Kit

MBS8426514-01 1 Kit

Mouse Transforming Growth Factor Alpha CLIA Kit

Sign In for Pricing

Mouse Transforming Growth Factor Alpha CLIA Kit

MBS8426514-02 5x 1 Kit

Mouse Transforming Growth Factor Alpha CLIA Kit

Sign In for Pricing

KCTD7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

LV688847 1.0 µg DNA

KCTD7 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing