Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2, Human (His)

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].

Product Specifications

Product Name Alternative

APOC2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH

Molecular Formula

344 (Gene_ID) P02655 (T23-E101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PI3K p85 (Y467) + PI3K p55 (Y199) Recombinant Rabbit monoclonal Antibody
HA750716 100 µL

Phospho-PI3K p85 (Y467) + PI3K p55 (Y199) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SETMAR (NM_006515) Human Over-expression Lysate
LY432352 100 µg

SETMAR (NM_006515) Human Over-expression Lysate

Sign In for Pricing
View Details
p47phox Antibody / NCF1
RQ4196 100 µg

p47phox Antibody / NCF1

Sign In for Pricing
View Details
Desmocollin 1 Recombinant Rabbit Monoclonal Antibody [JE66-57]
HA721418 100 µL

Desmocollin 1 Recombinant Rabbit Monoclonal Antibody [JE66-57]

Sign In for Pricing
View Details
DNAJB9 (NM_012328) Human Over-expression Lysate
LY402196 100 µg

DNAJB9 (NM_012328) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Myeloid tissue
CS808511 5x 5 µm

Tissue FFPE Sections, Myeloid tissue

Sign In for Pricing
View Details