APOC2, Human (His)
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].
Product Specifications
Product Name Alternative
APOC2 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH
Molecular Formula
344 (Gene_ID) P02655 (T23-E101) (Accession)
Molecular Weight
Approximately 13 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
WD Repeat Containing Domain Protein 52 (WDR52) BioAssayTM ELISA Kit (Human)
ATG14, NT (ATG14, KIAA0831, Beclin 1-associated autophagy-related key regulator, Autophagy-related protein 14-like protein) (MaxLight 750)
ATG14, NT (ATG14, KIAA0831, Beclin 1-associated autophagy-related key regulator, Autophagy-related protein 14-like protein) (MaxLight 750)
