Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOC2, Human (His)

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].

Product Specifications

Product Name Alternative

APOC2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH

Molecular Formula

344 (Gene_ID) P02655 (T23-E101) (Accession)

Molecular Weight

Approximately 13 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD4 Antibody[SK3]
E-AB-F1352D-01 20 Tests

PE Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
PE Anti-Human CD4 Antibody[SK3]
E-AB-F1352D-02 100 Tests

PE Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
PE Anti-Human CD4 Antibody[SK3]
E-AB-F1352D-03 2x 100 Tests

PE Anti-Human CD4 Antibody[SK3]

Sign In for Pricing
View Details
1-Arachidoyl-sn-glycero-3-phosphocholine
TRC-A765095-25MG 25 mg

1-Arachidoyl-sn-glycero-3-phosphocholine

Sign In for Pricing
View Details
CD117 (C117/370), CF640R conjugate, 0.1mg/mL
BNC400370-500 1x 500 µL

CD117 (C117/370), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]
TA505841BM 100 µL

MEK3 (MAP2K3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details