Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR4, Human (sf9, His, Solution)

TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

Product Specifications

Product Name Alternative

TLR4 Protein, Human (sf9, His, Solution), Human, Sf9 insect cells

UNSPSC

12352202

Purity

91.40

Smiles

ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Molecular Formula

7099 (Gene_ID) O00206-1 (E24-K631) (Accession)

Molecular Weight

Approximately 68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D3 (CCND3) Rabbit Polyclonal Antibody
TA374380 100 µL

Cyclin D3 (CCND3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45RO (190-2F2.5), Biotin conjugate, 0.1mg/mL
BNCB1081-500 1x 500 µL

CD45RO (190-2F2.5), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tin2 Recombinant Rabbit Monoclonal Antibody [JE35-82]
HA722432 100 µL

Tin2 Recombinant Rabbit Monoclonal Antibody [JE35-82]

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-01 20 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-02 100 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-03 500 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details