Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR4, Human (sf9, His, Solution)

TLR4 is a transmembrane receptor that recognizes PAMPs and DAMPs and cooperates with LY96 for LPS detection. TLR4 activates MYD88-dependent and independent signaling pathways and participates in TIRAP, TRAF6 and CD14-mediated endocytosis. TLR4 Protein, Human (sf9, His, Solution) is the recombinant human-derived TLR4 protein, expressed by Sf9 insect cells, with C-His labeled tag.

Product Specifications

Product Name Alternative

TLR4 Protein, Human (sf9, His, Solution), Human, Sf9 insect cells

UNSPSC

12352202

Purity

91.40

Smiles

ESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Molecular Formula

7099 (Gene_ID) O00206-1 (E24-K631) (Accession)

Molecular Weight

Approximately 68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (mutated K27 M) Recombinant Rabbit Monoclonal Antibody [JE46-51]
HA722200 100 µL

Histone H3 (mutated K27 M) Recombinant Rabbit Monoclonal Antibody [JE46-51]

Sign In for Pricing
View Details
RHOBTB3 Antibody
8C18407-AAT 50 µg

RHOBTB3 Antibody

Sign In for Pricing
View Details
Human KIAA1143 activation kit by CRISPRa
GA111502 1 Kit

Human KIAA1143 activation kit by CRISPRa

Sign In for Pricing
View Details
TRPV1 Recombinant Mouse monoclonal Antibody
HA601435 100 µL

TRPV1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706524 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant AREB6 Monoclonal Antibody
AN301025L-01 50 µL

Recombinant AREB6 Monoclonal Antibody

Sign In for Pricing
View Details