Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-beta, Rhesus Macaque (HEK293, Fc, Solution)

IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.

Product Specifications

Product Name Alternative

IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution), Rhesus Macaque, HEK293

UNSPSC

12352202

Purity

85.0

Smiles

MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN

Molecular Formula

/ (Gene_ID) EHH24077.1 (M22-N187) (Accession)

Molecular Weight

Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

A-674563 HCl
MBS3609400-01 2 mg

A-674563 HCl

Sign In for Pricing
View Details
A-674563 HCl
MBS3609400-02 5 mg

A-674563 HCl

Sign In for Pricing
View Details
A-674563 HCl
MBS3609400-03 10 mg

A-674563 HCl

Sign In for Pricing
View Details
A-674563 HCl
MBS3609400-04 25 mg

A-674563 HCl

Sign In for Pricing
View Details
A-674563 HCl
MBS3609400-05 50 mg

A-674563 HCl

Sign In for Pricing
View Details
HLA B7 Rabbit mAb
E60M3376 100 µL

HLA B7 Rabbit mAb

Sign In for Pricing
View Details