IFN-beta, Rhesus Macaque (HEK293, Fc, Solution)
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.
Product Specifications
Product Name Alternative
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution), Rhesus Macaque, HEK293
UNSPSC
12352202
Purity
85.0
Smiles
MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN
Molecular Formula
/ (Gene_ID) EHH24077.1 (M22-N187) (Accession)
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0243203 1.0 µg DNA
C6orf15 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
CK-bio-16596-01 48 Tests
Mouse Methionine Adenosyltransferase I Alpha (MAT1a)
Sign In for Pricing
View Details 
CK-bio-16596-02 96 Tests
Mouse Methionine Adenosyltransferase I Alpha (MAT1a)
Sign In for Pricing
View Details CK-bio-16596-03 5x 96 Tests
Mouse Methionine Adenosyltransferase I Alpha (MAT1a)
Sign In for Pricing
View Details CK-bio-16596-04 10x 96 Tests
Mouse Methionine Adenosyltransferase I Alpha (MAT1a)
Sign In for Pricing
View Details