IFN-beta, Rhesus Macaque (HEK293, Fc, Solution)
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.
Product Specifications
Product Name Alternative
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution), Rhesus Macaque, HEK293
UNSPSC
12352202
Purity
85.0
Smiles
MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN
Molecular Formula
/ (Gene_ID) EHH24077.1 (M22-N187) (Accession)
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9419924-01 0.05 mL
Recombinant Human Tumor Necrosis Factor-a (rHu TNF-a)
Sign In for Pricing
View Details 
MBS9419924-02 5x 0.05 mL
Recombinant Human Tumor Necrosis Factor-a (rHu TNF-a)
Sign In for Pricing
View Details