IFN-beta, Rhesus Macaque (HEK293, Fc, Solution)
Selected Variant
HY-P73132Y-01
Size: 10 µg
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution) is the recombinant rhesus macaque-derived IFN-beta protein, expressed by HEK293, with C-mFc tag.
Product Specifications
Product Name Alternative
IFN-beta Protein, Rhesus Macaque (HEK293, Fc, Solution), Rhesus Macaque, HEK293
UNSPSC
12352202
Purity
85.0
Smiles
MSYNLLGFLQRSSSFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVENLLANVYHQIDHLKTILEEKLEKEDFTRGKFVSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINKLTGYLRN
Molecular Formula
/ (Gene_ID) EHH24077.1 (M22-N187) (Accession)
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9022-Cy3 100 µg/Vial
Anti-CCL3/Macrophage Inflammatory Protein 1 alpha Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 
BNCB1821-100 1x 100 µL
Langerin / CD207 (Marker of Langerhans Cells) (LGRN/1821), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040041-100 1x 100 µL
Cytokeratin 18 (C-04), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
A11256-1-Cy3 100 µg/Vial
Anti-GHITM Antibody Picoband®, Cy3 Conjugate
Sign In for Pricing
View Details 
BNUB2717-100 1x 100 µL
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), 0.2mg/mL
Sign In for Pricing
View Details 
M02333-carrier-free 100 µL
Anti-delta 1 Catenin/p120 Catenin Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details