MDC/CCL22, Mouse
CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.
Product Specifications
Product Name Alternative
MDC/CCL22 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Purity
95.00
Smiles
GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Molecular Formula
20299 (Gene_ID) O88430 (G25-S92) (Accession)
Molecular Weight
Approximately 10 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS646768-01 0.05 mg
UTP11L (UTP11-like Protein, CGI94, CGI-94, HDCMB12P, Probable U3 Small Nucleolar RNA-associated Protein 11, U3 snoRNA-associated Protein 11)
Sign In for Pricing
View Details MBS646768-02 5x 0.05 mg
UTP11L (UTP11-like Protein, CGI94, CGI-94, HDCMB12P, Probable U3 Small Nucleolar RNA-associated Protein 11, U3 snoRNA-associated Protein 11)
Sign In for Pricing
View Details 
IFRIL6YSTNT6XHIS200ug 1 Each
Ferret IL-6 Recombinant Yeast N-Terminal 6xHis Tagged
Sign In for Pricing
View Details MBS1471691-01 0.02 mg (E-Coli)
Recombinant Human RING finger protein 44 (RNF44)
Sign In for Pricing
View Details MBS1471691-02 0.02 mg (Yeast)
Recombinant Human RING finger protein 44 (RNF44)
Sign In for Pricing
View Details MBS1471691-03 0.1 mg (E-Coli)
Recombinant Human RING finger protein 44 (RNF44)
Sign In for Pricing
View Details