Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Mouse

CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Molecular Formula

20299 (Gene_ID) O88430 (G25-S92) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cercosporamide
9662-500 500 µg

Cercosporamide

Sign In for Pricing
View Details
PHF2 Rabbit Polyclonal Antibody (BF350)
orb2418343 100 µL

PHF2 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
PD-1/PDCD1/PD Rabbit Polyclonal Antibody (Fluoro488)
orb3119667 100 µg

PD-1/PDCD1/PD Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
2-Methyl-d3 Ethynyl Estradiol
CS-T-99478 1 Each

2-Methyl-d3 Ethynyl Estradiol

Sign In for Pricing
View Details
DR5 (Apo2, Trail-R2, TRAIL Receptor2, Trick2, Killer, Death Receptor5, CD262, KILLER, KILLER/DR5, TNFRSF10B, TRANCE-R, TRICKB, Tumor Necrosis Factor Receptor Superfamily, Member 10b, ZTNFR9) (MaxLight 490)
MBS6472973-01 0.1 mL

DR5 (Apo2, Trail-R2, TRAIL Receptor2, Trick2, Killer, Death Receptor5, CD262, KILLER, KILLER/DR5, TNFRSF10B, TRANCE-R, TRICKB, Tumor Necrosis Factor Receptor Superfamily, Member 10b, ZTNFR9) (MaxLight 490)

Sign In for Pricing
View Details
DR5 (Apo2, Trail-R2, TRAIL Receptor2, Trick2, Killer, Death Receptor5, CD262, KILLER, KILLER/DR5, TNFRSF10B, TRANCE-R, TRICKB, Tumor Necrosis Factor Receptor Superfamily, Member 10b, ZTNFR9) (MaxLight 490)
MBS6472973-02 5x 0.1 mL

DR5 (Apo2, Trail-R2, TRAIL Receptor2, Trick2, Killer, Death Receptor5, CD262, KILLER, KILLER/DR5, TNFRSF10B, TRANCE-R, TRICKB, Tumor Necrosis Factor Receptor Superfamily, Member 10b, ZTNFR9) (MaxLight 490)

Sign In for Pricing
View Details