Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Mouse

CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Molecular Formula

20299 (Gene_ID) O88430 (G25-S92) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IgG2b Kappa Isotype Control Monoclonal Clone LTF2 APC Ready To Use 200 Tests
IRTIGG2BKICLTF2CAPC200 200 Tests

Rat IgG2b Kappa Isotype Control Monoclonal Clone LTF2 APC Ready To Use 200 Tests

Sign In for Pricing
View Details
Glutaredoxin-2, Mitochondrial, CT, T135 (GLRX2, GRX2, CGI-133) (HRP) discontinued
G5012-03-HRP 200 µL

Glutaredoxin-2, Mitochondrial, CT, T135 (GLRX2, GRX2, CGI-133) (HRP) discontinued

Sign In for Pricing
View Details
GLTSCR2 Recombinant Protein (Rat)
RP202859 100 µg

GLTSCR2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Accuris Aspire Laboratory Aspirator Set
ASP1086 1 Each

Accuris Aspire Laboratory Aspirator Set

Sign In for Pricing
View Details
Biotin-PEG-Biotin (MW 5000)
T208170-01 10 mg

Biotin-PEG-Biotin (MW 5000)

Sign In for Pricing
View Details
Biotin-PEG-Biotin (MW 5000)
T208170-02 50 mg

Biotin-PEG-Biotin (MW 5000)

Sign In for Pricing
View Details