Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Mouse

CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Molecular Formula

20299 (Gene_ID) O88430 (G25-S92) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD26/DPP4 Antibody (SAA0009)
FHD74110 100 μg

Anti-Human CD26/DPP4 Antibody (SAA0009)

Sign In for Pricing
View Details
IOLILYTE LBE 02 (56) 0-75
LBE-02 (56) 0-75-HP-0100 100 g

IOLILYTE LBE 02 (56) 0-75

Sign In for Pricing
View Details
Normal Human IgG Isotype Control Polyclonal Antibody (PerCP)
orb2972253-01 50 Tests

Normal Human IgG Isotype Control Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Normal Human IgG Isotype Control Polyclonal Antibody (PerCP)
orb2972253-02 100 Tests

Normal Human IgG Isotype Control Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Anti-Human CD371/CLEC12A Monoclonal Antibody (ABS0850), PerCP
PTX23480 100 µg

Anti-Human CD371/CLEC12A Monoclonal Antibody (ABS0850), PerCP

Sign In for Pricing
View Details
Recombinant Transforming Growth Factor Beta 1 (TGFb1)
TRV-0007217-01 10 µg

Recombinant Transforming Growth Factor Beta 1 (TGFb1)

Sign In for Pricing
View Details