Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDC/CCL22, Mouse

CCL22/MDC Protein, Mouse is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Mouse (His) is a recombinant mouse CCL22/MDC (G25-S92) protein expressed by E. coli.

Product Specifications

Product Name Alternative

MDC/CCL22 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Molecular Formula

20299 (Gene_ID) O88430 (G25-S92) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg5 3'UTR Luciferase Stable Cell Line
TU102274 1.0 mL

Atg5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olfactory receptor 51B5 Polyclonal Antibody
JOT-AP06465-01 20 µL

Olfactory receptor 51B5 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 51B5 Polyclonal Antibody
JOT-AP06465-02 50 μL

Olfactory receptor 51B5 Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 51B5 Polyclonal Antibody
JOT-AP06465-03 100 µL

Olfactory receptor 51B5 Polyclonal Antibody

Sign In for Pricing
View Details
CIAO1, Recombinant, Human, aa1-339, His-SUMO-Tag (Probable Cytosolic Iron-sulfur Protein Assembly Protein CIAO1)
372772-01 20 µg

CIAO1, Recombinant, Human, aa1-339, His-SUMO-Tag (Probable Cytosolic Iron-sulfur Protein Assembly Protein CIAO1)

Sign In for Pricing
View Details
CIAO1, Recombinant, Human, aa1-339, His-SUMO-Tag (Probable Cytosolic Iron-sulfur Protein Assembly Protein CIAO1)
372772-02 100 µg

CIAO1, Recombinant, Human, aa1-339, His-SUMO-Tag (Probable Cytosolic Iron-sulfur Protein Assembly Protein CIAO1)

Sign In for Pricing
View Details