Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndn (NM_010882) Mouse Tagged ORF Clone
MR204720 10 µg

Ndn (NM_010882) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CNGB3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0474903 1.0 µg DNA

CNGB3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-SHPK Antibody, Affinity Purified
A305-719A 100 µg

Rabbit anti-SHPK Antibody, Affinity Purified

Sign In for Pricing
View Details
LEFTYA (Left-right Determination Factor 2, Protein Lefty-2, Left-right Determination Factor A, Protein Lefty-A, Transforming Growth Factor beta-4, TGF-beta-4, Endometrial Bleeding-associated Factor, EBAF, LEFTA, LEFTY2, TGFB4, PSEC0024, MGC46222) (MaxLight 750) discontinued
129059-ML750 100 µL

LEFTYA (Left-right Determination Factor 2, Protein Lefty-2, Left-right Determination Factor A, Protein Lefty-A, Transforming Growth Factor beta-4, TGF-beta-4, Endometrial Bleeding-associated Factor, EBAF, LEFTA, LEFTY2, TGFB4, PSEC0024, MGC46222) (MaxLight 750) discontinued

Sign In for Pricing
View Details
KDELR3 Recombinant Protein Antigen
NBP2-57455PEP 100 µL

KDELR3 Recombinant Protein Antigen

Sign In for Pricing
View Details
Dansylarginine-N-(3-ethyl-1,5-pentanediyl)amide (DAPA)
MBS635053-01 1 mg

Dansylarginine-N-(3-ethyl-1,5-pentanediyl)amide (DAPA)

Sign In for Pricing
View Details