Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCI Antibody Pair
55R-1019 5 plates

PCI Antibody Pair

Sign In for Pricing
View Details
KIAA1045 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1137905 3x 1.0 µg

KIAA1045 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Ribosomal Protein L8 (60S Ribosomal Protein L8, L8, RPL8) (HRP)
138289-HRP 100 µL

Ribosomal Protein L8 (60S Ribosomal Protein L8, L8, RPL8) (HRP)

Sign In for Pricing
View Details
Rabbit Monoclonal SIRP alpha/CD172a Antibody (009) [Alexa Fluor 405]
NBP2-90752AF405 0.1 mL

Rabbit Monoclonal SIRP alpha/CD172a Antibody (009) [Alexa Fluor 405]

Sign In for Pricing
View Details
Lentiviral human AMHR2 shRNA (UAS) - Lentiviral human AMHR2 shRNA (UAS) (25)
GTR15308480 1 Vial

Lentiviral human AMHR2 shRNA (UAS) - Lentiviral human AMHR2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human ANGPTL4 ELISA Kit
E002066-01 1 Each

Human ANGPTL4 ELISA Kit

Sign In for Pricing
View Details