Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF12 (1-402, His-tag) Human Protein
AR51645PU-N 500 µg

KLF12 (1-402, His-tag) Human Protein

Sign In for Pricing
View Details
Rabbit Polyclonal OSTM1 Antibody [Alexa Fluor 594]
NBP2-99663AF594 0.1 mL

Rabbit Polyclonal OSTM1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
C15orf28 Protein Vector (Human) (pPB-C-His)
PV049577 500 ng

C15orf28 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
STK25 Protein Vector (Human) (pPM-C-His)
PV040556 500 ng

STK25 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SGCZ (NM_139167) Human Over-expression Lysate
LH13956V 100 µg

SGCZ (NM_139167) Human Over-expression Lysate

Sign In for Pricing
View Details
VPS29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2618605 3x 1.0 µg

VPS29 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details