Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf116 Recombinant Protein (Human)
RP004177 100 µg

C1orf116 Recombinant Protein (Human)

Sign In for Pricing
View Details
Snrpn 3'UTR Luciferase Stable Cell Line
TU220914 1.0 mL

Snrpn 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
[KO Validated] BCKDHA Rabbit pAb
A19962 50 µL

[KO Validated] BCKDHA Rabbit pAb

Sign In for Pricing
View Details
Mouse IL-25 (IL-17E) ELISA KIT
MBS9424857-01 96 Tests

Mouse IL-25 (IL-17E) ELISA KIT

Sign In for Pricing
View Details
Mouse IL-25 (IL-17E) ELISA KIT
MBS9424857-02 5x 96 Tests

Mouse IL-25 (IL-17E) ELISA KIT

Sign In for Pricing
View Details
Human C10orf126 shRNA Plasmid
abx966861-01 150 µg

Human C10orf126 shRNA Plasmid

Sign In for Pricing
View Details