Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTRP1 (C1QTNF1) (N-term) Rabbit Polyclonal Antibody
AP17159PU-N 400 µL

CTRP1 (C1QTNF1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Canine Tissue Factor (TF) ELISA Kit
AE17060DO-01 48 Tests

Canine Tissue Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Canine Tissue Factor (TF) ELISA Kit
AE17060DO-02 96 Tests

Canine Tissue Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Phospho-ATF2 (Thr55) Rabbit pAb
E47R8450 100 µL

Phospho-ATF2 (Thr55) Rabbit pAb

Sign In for Pricing
View Details
Mir1966 Mouse MicroRNA Expression Plasmid (MI0009963)
SC400882 10 µg

Mir1966 Mouse MicroRNA Expression Plasmid (MI0009963)

Sign In for Pricing
View Details
CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (PE)
MBS6372981-01 0.1 mL

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (PE)

Sign In for Pricing
View Details