Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plasminogen, Human

Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Plasminogen Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

Molecular Formula

5340 (Gene_ID) P00747 (V98-P356) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBABE-hLin28B
BZ11876 1 Vial

PBABE-hLin28B

Sign In for Pricing
View Details
MATR3 Rabbit pAb, PE-Cy5.5 conjugated
orb2870485 100 µL

MATR3 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Serine/Threonine-Protein Phosphatase 2A Regulatory Subunit B (PPP2R3A) Antibody
abx339584-01 50 µL

Serine/Threonine-Protein Phosphatase 2A Regulatory Subunit B (PPP2R3A) Antibody

Sign In for Pricing
View Details
Serine/Threonine-Protein Phosphatase 2A Regulatory Subunit B (PPP2R3A) Antibody
abx339584-02 100 µL

Serine/Threonine-Protein Phosphatase 2A Regulatory Subunit B (PPP2R3A) Antibody

Sign In for Pricing
View Details
CNTD (CNTD1) (NM_173478) Human Tagged ORF Clone
RC206108 10 µg

CNTD (CNTD1) (NM_173478) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Ischemia modified albumin (IMA) ELISA Kit
MBS261777-01 48 Well

Mouse Ischemia modified albumin (IMA) ELISA Kit

Sign In for Pricing
View Details