Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plasminogen, Human

Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Plasminogen Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

Molecular Formula

5340 (Gene_ID) P00747 (V98-P356) (Accession)

Molecular Weight

Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Arl16 shRNA (UAS) - Lentiviral mouse Arl16 shRNA (UAS, GFP) (100)
GTR15279201 1 Vial

Lentiviral mouse Arl16 shRNA (UAS) - Lentiviral mouse Arl16 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MFSD12 Rabbit Polyclonal Antibody (APC)
orb2584373 100 µg

MFSD12 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
IGFBP5 ELISA Kit (Human) (OKEH04865)
OKEH04865 96 Well

IGFBP5 ELISA Kit (Human) (OKEH04865)

Sign In for Pricing
View Details
PRKAA2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
37621154 3x 1.0 µg DNA

PRKAA2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CKS2 Rabbit pAb, PE-Cy5 conjugated
orb2854366 100 µL

CKS2 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
PRX (NM_020956) Human Tagged Lenti ORF Clone
RC216161L2 10 µg

PRX (NM_020956) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details