Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lipocalin-2/NGAL, Human

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Lipocalin-2/NGAL Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Molecular Formula

3934 (Gene_ID) P80188-1 (Q21-G198) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin Converting Enzyme 1 (ACE) (NM_001178057) Human Over-expression Lysate
LC433435 20 µg

Angiotensin Converting Enzyme 1 (ACE) (NM_001178057) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SLC24A3 activation kit by CRISPRa
GA111493 1 Kit

Human SLC24A3 activation kit by CRISPRa

Sign In for Pricing
View Details
CHmL Human Gene Knockout Kit (CRISPR)
KN418675 1 Kit

CHmL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSC Human Knockdown Lysate
LY300187 100 µg

GSC Human Knockdown Lysate

Sign In for Pricing
View Details
Penicillic Acid
TRC-P223530-5MG 5 mg

Penicillic Acid

Sign In for Pricing
View Details
Human ZFP14 activation kit by CRISPRa
GA111676 1 Kit

Human ZFP14 activation kit by CRISPRa

Sign In for Pricing
View Details