Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lipocalin-2/NGAL, Human

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Lipocalin-2/NGAL Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Molecular Formula

3934 (Gene_ID) P80188-1 (Q21-G198) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse ITK Kinase Protein (aa 351-619, His & GST Tag)
PKSM040718 50 µg

Recombinant Mouse ITK Kinase Protein (aa 351-619, His & GST Tag)

Sign In for Pricing
View Details
BIN1 Antibody
KC-928-01 50 μL

BIN1 Antibody

Sign In for Pricing
View Details
BIN1 Antibody
KC-928-02 100 µL

BIN1 Antibody

Sign In for Pricing
View Details
BIN1 Antibody
KC-928-03 1 mL

BIN1 Antibody

Sign In for Pricing
View Details
Valproic Acid
TRC-V094750-10G 10 g

Valproic Acid

Sign In for Pricing
View Details
TentaGel® MB CHO
MB160006.1G 1 g

TentaGel® MB CHO

Sign In for Pricing
View Details