Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lipocalin-2/NGAL, Human

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Lipocalin-2/NGAL Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Molecular Formula

3934 (Gene_ID) P80188-1 (Q21-G198) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myelin oligodendrocyte glycoprotein (MOG) Rabbit Polyclonal Antibody
TA361869 100 µL

Myelin oligodendrocyte glycoprotein (MOG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB605512 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL
BNC881788-100 1x 100 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD1d Antibody[20H2]
AN00570H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD1d Antibody[20H2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD1d Antibody[20H2]
AN00570H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD1d Antibody[20H2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD1d Antibody[20H2]
AN00570H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD1d Antibody[20H2]

Sign In for Pricing
View Details