Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lipocalin-2/NGAL, Human

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Lipocalin-2/NGAL Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Molecular Formula

3934 (Gene_ID) P80188-1 (Q21-G198) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC388436 (NM_001291905) Human Tagged ORF Clone
RG235694 10 µg

LOC388436 (NM_001291905) Human Tagged ORF Clone

Sign In for Pricing
View Details
FAAP24 Polyclonal Antibody
E-AB-17929-01 20 µL

FAAP24 Polyclonal Antibody

Sign In for Pricing
View Details
FAAP24 Polyclonal Antibody
E-AB-17929-02 60 µL

FAAP24 Polyclonal Antibody

Sign In for Pricing
View Details
FAAP24 Polyclonal Antibody
E-AB-17929-03 120 µL

FAAP24 Polyclonal Antibody

Sign In for Pricing
View Details
FAAP24 Polyclonal Antibody
E-AB-17929-04 200 µL

FAAP24 Polyclonal Antibody

Sign In for Pricing
View Details
Human Protor 1 (PRR5) activation kit by CRISPRa
GA110825 1 Kit

Human Protor 1 (PRR5) activation kit by CRISPRa

Sign In for Pricing
View Details