Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylokinase, Staphylococcus phage (His)

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Product Specifications

Product Name Alternative

Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Molecular Formula

/ (Gene_ID) P15240 (S28-K163) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ryanodine Receptor 1, Skeletal (RYR1) ELISA Kit
RD-RYR1-Hu-01 96 Tests

Human Ryanodine Receptor 1, Skeletal (RYR1) ELISA Kit

Sign In for Pricing
View Details
Human Ryanodine Receptor 1, Skeletal (RYR1) ELISA Kit
RD-RYR1-Hu-02 48 Tests

Human Ryanodine Receptor 1, Skeletal (RYR1) ELISA Kit

Sign In for Pricing
View Details
Datura Stramonium Lectin (DSL), CF®594 Conjugate
#29099 1x 1 mL

Datura Stramonium Lectin (DSL), CF®594 Conjugate

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF740 conjugate, 0.1mg/mL
BNC740744-100 1x 100 µL

Prolactin Receptor (B6.2 + PRLR742), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP02655PU-S 50 µL

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tram2 Mouse Gene Knockout Kit (CRISPR)
KN518137 1 Kit

Tram2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details