Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylokinase, Staphylococcus phage (His)

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Product Specifications

Product Name Alternative

Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Molecular Formula

/ (Gene_ID) P15240 (S28-K163) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A4 Human Recombinant Protein, Synthetic Nanodisc
TP721404M 100 µg

SLC25A4 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
Adiponectin receptor protein 1 Recombinant Rabbit monoclonal Antibody
HA750233 100 µL

Adiponectin receptor protein 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(1R)-(+)-a-Pinene (97% ee)
TRC-P466613-500MG 500 mg

(1R)-(+)-a-Pinene (97% ee)

Sign In for Pricing
View Details
Carboxyformamido Metazachlor Benzoic Acid
TRC-M854590-10MG 10 mg

Carboxyformamido Metazachlor Benzoic Acid

Sign In for Pricing
View Details
Intedanib
TRC-I666650-10MG 10 mg

Intedanib

Sign In for Pricing
View Details
3-Amino-N-(3-carbamoyl-1-carboxypropyl)phthalamic Acid
TRC-A599220-2.5MG 2.5 mg

3-Amino-N-(3-carbamoyl-1-carboxypropyl)phthalamic Acid

Sign In for Pricing
View Details