Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylokinase, Staphylococcus phage (His)

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Product Specifications

Product Name Alternative

Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Molecular Formula

/ (Gene_ID) P15240 (S28-K163) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (C4/206), CF568 conjugate, 0.1mg/mL
BNC680206-100 1x 100 µL

CD4 (C4/206), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
U2surp Mouse Gene Knockout Kit (CRISPR)
KN518538 1 Kit

U2surp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mel18 (PCGF2) (Center) Rabbit Polyclonal Antibody
AP53218PU-N 400 µL

Mel18 (PCGF2) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1,2-Distearoyl-sn-glycero-3-phospho-rac-(1-glycerol) Sodium Salt
TRC-D493585-250MG 250 mg

1,2-Distearoyl-sn-glycero-3-phospho-rac-(1-glycerol) Sodium Salt

Sign In for Pricing
View Details
Rpp21 (NM_026308) Mouse Tagged ORF Clone
MG201065 10 µg

Rpp21 (NM_026308) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD74 (LN-2), CF594 conjugate, 0.1mg/mL
BNC940056-500 1x 500 µL

CD74 (LN-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details