Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylokinase, Staphylococcus phage (His)

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Product Specifications

Product Name Alternative

Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Molecular Formula

/ (Gene_ID) P15240 (S28-K163) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS803467 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Frozen Tissue Sections, Uterus
CS509978 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details
PE Anti-Mouse IL-6 Antibody[MP5-20F3]
E-AB-F1207D-01 50 Tests

PE Anti-Mouse IL-6 Antibody[MP5-20F3]

Sign In for Pricing
View Details
PE Anti-Mouse IL-6 Antibody[MP5-20F3]
E-AB-F1207D-02 100 Tests

PE Anti-Mouse IL-6 Antibody[MP5-20F3]

Sign In for Pricing
View Details
PE Anti-Mouse IL-6 Antibody[MP5-20F3]
E-AB-F1207D-03 2x 100 Tests

PE Anti-Mouse IL-6 Antibody[MP5-20F3]

Sign In for Pricing
View Details
FAM53A (NM_001174070) Human Over-expression Lysate
LY432997 100 µg

FAM53A (NM_001174070) Human Over-expression Lysate

Sign In for Pricing
View Details