Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Staphylokinase, Staphylococcus phage (His)

Staphylococcal kinase protein is a potent plasminogen activator that converts plasminogen into active plasmin. In addition to activation, staphylococcal kinase forms a 1:1 complex with plasmin, enabling activated plasmin to catalyze the conversion of other plasminogen molecules. Staphylokinase Protein, Staphylococcus phage (His) is the recombinant mouse-derived Staphylokinase protein, expressed by E. coli , with N-6*His labeled tag. The total length of Staphylokinase Protein, Staphylococcus phage (His) is 136 a.a., with molecular weight of ~17 kDa.

Product Specifications

Product Name Alternative

Staphylokinase Protein, Staphylococcus phage (His), Others, E. coli

UNSPSC

12352202

Purity

98.0

Smiles

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKRNELLSPRYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Molecular Formula

/ (Gene_ID) P15240 (S28-K163) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ethanolamine kinase (ETNK1) (NM_001039481) Human Recombinant Protein
TP311556M 100 µg

ethanolamine kinase (ETNK1) (NM_001039481) Human Recombinant Protein

Sign In for Pricing
View Details
TentaGel® R HMBA
R28014.1G 1 g

TentaGel® R HMBA

Sign In for Pricing
View Details
CD74 (CLIP/813), CF488A conjugate, 0.1mg/mL
BNC880813-100 1x 100 µL

CD74 (CLIP/813), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BLOC1S1 (NM_001487) Human Over-expression Lysate
LY419897 100 µg

BLOC1S1 (NM_001487) Human Over-expression Lysate

Sign In for Pricing
View Details
2′-Deoxyuridine 4-oxime
TRC-D308930-10MG 10 mg

2′-Deoxyuridine 4-oxime

Sign In for Pricing
View Details
SLC2A6 Rabbit Polyclonal Antibody
TA367467 100 µL

SLC2A6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details