Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptokinase G, Streptococcus sp. (His)

Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Streptokinase G Protein, Streptococcus sp. (His), Others, E. coli

UNSPSC

12352202

Purity

98.00

Smiles

IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK

Molecular Formula

/ (Gene_ID) P10519 (I27-K440) (Accession)

Molecular Weight

Predict MW: 48.16 kDa; Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C.I.Vat Yellow 2 (Technical Grade)
TRC-C475860-250MG 250 mg

C.I.Vat Yellow 2 (Technical Grade)

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF405S conjugate, 0.1mg/mL
BNC042593-100 1x 100 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GOLT1A activation kit by CRISPRa
GA115018 1 Kit

Human GOLT1A activation kit by CRISPRa

Sign In for Pricing
View Details
INSC Rabbit Polyclonal Antibody
TA372780 100 µL

INSC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DUSP9 (NM_001395) Human Recombinant Protein
TP309271 20 µg

DUSP9 (NM_001395) Human Recombinant Protein

Sign In for Pricing
View Details
Monobutyl Phosphate Biscyclohexylamine Salt
TRC-M525055-1G 1 g

Monobutyl Phosphate Biscyclohexylamine Salt

Sign In for Pricing
View Details