Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptokinase G, Streptococcus sp. (His)

Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Streptokinase G Protein, Streptococcus sp. (His), Others, E. coli

UNSPSC

12352202

Purity

98.00

Smiles

IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK

Molecular Formula

/ (Gene_ID) P10519 (I27-K440) (Accession)

Molecular Weight

Predict MW: 48.16 kDa; Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phalloidin-iFluor® 790 Conjugate
23131-AAT 300 Tests

Phalloidin-iFluor® 790 Conjugate

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF594 conjugate, 0.1mg/mL
BNC943439-100 1x 100 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LOC780933 Rabbit Polyclonal Antibody
TA396868 100 µg

LOC780933 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRITC-DHPE
23301-AAT 1 mg

TRITC-DHPE

Sign In for Pricing
View Details
PLEKHG4 Antibody
8C18077-AAT 50 µg

PLEKHG4 Antibody

Sign In for Pricing
View Details
GIP Rabbit Polyclonal Antibody
TA363913 50 µL

GIP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details