Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Streptokinase G, Streptococcus sp. (His)

Streptokinase G protein, devoid of protease activity, complexes with plasminogen, inducing its activation. Serving as a potential virulence factor, Streptokinase G is implicated in hindering robust fibrin barriers at infection sites, potentially augmenting microbial pathogenicity. Its activation of plasminogen highlights its role in manipulating the host's fibrinolytic system—a strategy employed to evade defenses and enhance infection. Streptokinase G Protein, Streptococcus sp. (His) is the recombinant Streptokinase G protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Streptokinase G Protein, Streptococcus sp. (His), Others, E. coli

UNSPSC

12352202

Purity

98.00

Smiles

IAGPEWLLDRPSVNNSQLVVSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKLFATDSGAMPHKLEKADLLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPIQPVQEFLLKGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFRPALKDTKLLKTLAIGDTITSQELLAQAQSILNKNHPGYTIYERDSSIVTHDNDIFRTILPMDQEFTYHVKNREQAYRINKKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLLTASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRPEGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK

Molecular Formula

/ (Gene_ID) P10519 (I27-K440) (Accession)

Molecular Weight

Predict MW: 48.16 kDa; Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS704796 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Bnip3 Mouse Gene Knockout Kit (CRISPR)
KN502214 1 Kit

Bnip3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HEY1 Human Gene Knockout Kit (CRISPR)
KN400257 1 Kit

HEY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
H4C1 Rabbit Monoclonal Antibody [Clone ID: R04-6U-3]
TA421390 100 µL

H4C1 Rabbit Monoclonal Antibody [Clone ID: R04-6U-3]

Sign In for Pricing
View Details
(DHQ)2PHAL
TRC-D299920-500MG 500 mg

(DHQ)2PHAL

Sign In for Pricing
View Details
Recombinant ATF-4 Monoclonal Antibody
AN301041L-01 50 µL

Recombinant ATF-4 Monoclonal Antibody

Sign In for Pricing
View Details