Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANK/TNFRSF11A, Human

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RANK/TNFRSF11A Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

96.00

Smiles

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Molecular Formula

8792 (Gene_ID) Q9Y6Q6-1 (Q29-K202) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BstNSI, 200U
RE1232 200 U

BstNSI, 200U

Sign In for Pricing
View Details
HRASLS3 (PLA2G16) Rabbit Polyclonal Antibody
TA367677 100 µL

HRASLS3 (PLA2G16) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX17 Mouse Monoclonal Antibody [Clone ID: OTI1C2]
CF812117 100 µg

COX17 Mouse Monoclonal Antibody [Clone ID: OTI1C2]

Sign In for Pricing
View Details
2-Cyclohexylvinylboronic Acid
TRC-C991798-1G 1 g

2-Cyclohexylvinylboronic Acid

Sign In for Pricing
View Details
Human ARH (LDLRAP1) activation kit by CRISPRa
GA108759 1 Kit

Human ARH (LDLRAP1) activation kit by CRISPRa

Sign In for Pricing
View Details
LAMP2 (NM_001122606) Human Recombinant Protein
TP720402XL 1 mg

LAMP2 (NM_001122606) Human Recombinant Protein

Sign In for Pricing
View Details