Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANK/TNFRSF11A, Human

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RANK/TNFRSF11A Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

96.00

Smiles

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Molecular Formula

8792 (Gene_ID) Q9Y6Q6-1 (Q29-K202) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Preactivated PE-Cy7 Tandem
2582-AAT 1 mg

ReadiUse™ Preactivated PE-Cy7 Tandem

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS624808 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Polystyrene A SH
HA12516004.0.5G 5 g

Polystyrene A SH

Sign In for Pricing
View Details
A530064D06Rik Mouse Gene Knockout Kit (CRISPR)
KN500557 1 Kit

A530064D06Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX58 Human Gene Knockout Kit (CRISPR)
KN417615 1 Kit

DDX58 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Medroxy Progesterone 17-Acetate
TRC-M203560-50MG 50 mg

Medroxy Progesterone 17-Acetate

Sign In for Pricing
View Details