Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANK/TNFRSF11A, Human

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RANK/TNFRSF11A Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

96.00

Smiles

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Molecular Formula

8792 (Gene_ID) Q9Y6Q6-1 (Q29-K202) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C11]
TA813264BM 100 µL

CD47 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C11]

Sign In for Pricing
View Details
(1’R,2R)-2-[(1’,2’-O-Isopropylidene)dihydroxyethyl]-6-fluorochroman-4-one
TRC-I824935-500MG 500 mg

(1’R,2R)-2-[(1’,2’-O-Isopropylidene)dihydroxyethyl]-6-fluorochroman-4-one

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF647 conjugate, 0.1mg/mL
BNC470245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STEAP1 (NM_012449) Human Recombinant Protein
TP303970L 1 mg

STEAP1 (NM_012449) Human Recombinant Protein

Sign In for Pricing
View Details
MIR5708 Human qPCR Primer Pair (MI0019316)
HP301257 200 Reactions

MIR5708 Human qPCR Primer Pair (MI0019316)

Sign In for Pricing
View Details
Steady-LucTM Firefly HTS Assay Kit, 10 x 1000 Assays
#30028-3 1 Kit

Steady-LucTM Firefly HTS Assay Kit, 10 x 1000 Assays

Sign In for Pricing
View Details