Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANK/TNFRSF11A, Human

RANK/TNFRSF11A protein is the receptor of TNFSF11/RANKL and is critical for RANKL-induced osteoclastogenesis. It interacts with EEIG1 to promote osteoclast formation by promoting NFATC1 transcription and activating PLCG2. RANK/TNFRSF11A Protein, Human is the recombinant human-derived RANK/TNFRSF11A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

RANK/TNFRSF11A Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

96.00

Smiles

QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Molecular Formula

8792 (Gene_ID) Q9Y6Q6-1 (Q29-K202) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse NRG-1 Protein (His Tag)
PDMM100120-01 20 µg

Recombinant Mouse NRG-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse NRG-1 Protein (His Tag)
PDMM100120-02 100 µg

Recombinant Mouse NRG-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse NRG-1 Protein (His Tag)
PDMM100120-03 500 µg

Recombinant Mouse NRG-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse NRG-1 Protein (His Tag)
PDMM100120-04 1 mg

Recombinant Mouse NRG-1 Protein (His Tag)

Sign In for Pricing
View Details
Psma8 Mouse Gene Knockout Kit (CRISPR)
KN514096 1 Kit

Psma8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EpCAM Antibody
F53681-0.1ML 0.1 mL

EpCAM Antibody

Sign In for Pricing
View Details