Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF13B, Human

TNFRSF13B protein is a receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS and exhibits high-affinity binding to both ligands. Its activation stimulates B-cell and T-cell function and modulates humoral immunity through calcineurin-dependent NF-AT activation as well as NF-kappa-B and AP-1 activation. TNFRSF13B Protein, Human is the recombinant human-derived TNFRSF13B protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TNFRSF13B Protein, Human, Human, E. coli

UNSPSC

12352202

Purity

95.00

Smiles

MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

Molecular Formula

23495 (Gene_ID) O14836-1 (M1-V160) (Accession)

Molecular Weight

Approximately 19.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PNPO (AK026905) Human Untagged Clone
SC103078 10 µg

PNPO (AK026905) Human Untagged Clone

Ask
View Details
SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (Biotin)
MBS6174582-01 0.1 mL

SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (Biotin)

Ask
View Details
SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (Biotin)
MBS6174582-02 5x 0.1 mL

SP3 (Sp3 Transcription Factor, DKFZp686O1631, SPR-2) (Biotin)

Ask
View Details
TLE4 Human qPCR Template Standard (NM_007005)
HK209955 1 Kit

TLE4 Human qPCR Template Standard (NM_007005)

Ask
View Details
Rabbit Monoclonal HOXB4 Antibody (SR1562)
NBP3-22246-100ul 100 µL

Rabbit Monoclonal HOXB4 Antibody (SR1562)

Ask
View Details
Lentiviral human ARHGEF19 sgRNA gene knockout kit - Lentiviral human ARHGEF19 sgRNA gene knockout kit (100)
GTR15370474 1 Vial

Lentiviral human ARHGEF19 sgRNA gene knockout kit - Lentiviral human ARHGEF19 sgRNA gene knockout kit (100)

Ask
View Details